Detailed Information
| Field | Value |
|---|---|
| Protein ID | 15234010 |
| Species | Arabidopsis thaliana |
| Sequence | MSGDNGGGERRKGSVKWFDTQKGFGFITPDDGGDDLFVHQSSIRSEGFRSLAAEEAVEFE VEIDNNNRPKAIDVSGPDGAPVQGNSGGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGG RGGGGRGGSDCYKCGEPGHMARDCSEGGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGG GGGSCYSCGESGHFARDCTSGGR |
GO Annotation
| GO | Name | Type | Source |
|---|---|---|---|
| GO:0005737 | cytoplasm | Cellular Component | IDA:UniProtKB |
| GO:0005829 | cytosol | Cellular Component | IDA:TAIR |
| GO:0005730 | nucleolus | Cellular Component | IDA:TAIR |
| GO:0005634 | nucleus | Cellular Component | IDA:TAIR |
| GO:0005886 | plasma membrane | Cellular Component | IDA:TAIR |
| GO:0003690 | double-stranded DNA binding | Molecular Function | IDA:UniProtKB |
| GO:0003729 | mRNA binding | Molecular Function | IDA:UniProtKB |
| GO:0003676 | nucleic acid binding | Molecular Function | ISS:TAIR |
| GO:0003697 | single-stranded DNA binding | Molecular Function | IDA:TAIR |
| GO:0008270 | zinc ion binding | Molecular Function | IEA:InterPro |
| GO:0009631 | cold acclimation | Biological Process | IGI:UniProtKB |
| GO:0032508 | DNA duplex unwinding | Biological Process | IDA:TAIR |
| GO:0043457 | regulation of cellular respiration | Biological Process | IMP:UniProtKB |
| GO:0006355 | regulation of transcription, DNA-templated | Biological Process | IEA:InterPro |
| GO:0009737 | response to abscisic acid | Biological Process | IEP:UniProtKB |
| GO:0009409 | response to cold | Biological Process | IEP:UniProtKB |
| GO:0009269 | response to desiccation | Biological Process | IEP:UniProtKB |
| GO:0009414 | response to water deprivation | Biological Process | IEP:UniProtKB |
| GO:0048316 | seed development | Biological Process | IMP:TAIR |
| GO:0048443 | stamen development | Biological Process | IMP:TAIR |
| GO:0010228 | vegetative to reproductive phase transition of meristem | Biological Process | IMP:TAIR |
Family and Domain
| Database | Entry |
|---|---|
| InParanoid | Q41188 |
| InterPro | IPR019844 Cold-shock_CS IPR011129 Cold_shock_prot IPR002059 CSP_DNA-bd IPR012340 NA-bd_OB-fold IPR001878 Znf_CCHC |
| Pfam | PF00313 CSD 1 hit PF00098 zf-CCHC 2 hits |
| PhylomeDB | Q41188 |
| PROSITE | PS00352 COLD_SHOCK 1 hit PS50158 ZF_CCHC 2 hits |
| SMART | SM00357 CSP 1 hit SM00343 ZnF_C2HC 2 hits |
Database Links
| Database | Entry |
|---|---|
| GeneID | 830024 |
| KEGG | ath:AT4G38680 |
| TAIR | AT4G38680 |
| UniProt | Q41188 |